This is similar to the level Verubecestat concentration of LL-37 reported in human plasma (1.18 μg/ml) [27], suggesting that this is a physiologically relevant potency of LL-37. Table 1 Peptides used in this study Antimicrobial Peptides Sequence Net charge NA-CATH KR F KKFFKK L KNSVKKR A KKFFKK P KVIGVTFPF 15 NA-CATH-ATRA1-ATRA1 KR F KKFFKK L KNSVKKR F KKFFK K LKVIGVTFPF 15 ATRA-1 KRFKKFFKKLK-NH2 8 ATRA-2 KRAKKFFKKPK-NH2 8 ATRA-1A KRAKKFFKKLK-NH2 8 LL-37 [LL-37, 37 aa]

6 D-LL-37 [LL-37, 37 aa] 6 Scrambled LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR 6 This table indicates the Sequence and charges of the antimicrobial peptides used. The ATRA motif is indicated in BOLD. The 3d and 10th positions of the ATRA peptides are underscored. The D-amino acids are indicated in italics. Figure 1 Effectiveness of anti-microbial peptides against S. aureus. Percent (%) survival was calculated by counting CFUs, after 3 hr incubations with various peptide concentrations {Selleck Anti-infection Compound Library|Selleck Antiinfection Compound Library|Selleck Anti-infection Compound Library|Selleck Antiinfection Compound Library|Selleckchem Anti-infection Compound Library|Selleckchem Antiinfection Compound Library|Selleckchem Anti-infection Compound Library|Selleckchem Antiinfection Compound Library|Anti-infection Compound Library|Antiinfection Compound Library|Anti-infection Compound Library|Antiinfection Compound Library|Anti-infection Compound Library|Antiinfection Compound Library|Anti-infection Compound Library|Antiinfection Compound Library|Anti-infection Compound Library|Antiinfection Compound Library|Anti-infection Compound Library|Antiinfection Compound Library|Anti-infection Compound Library|Antiinfection Compound Library|Anti-infection Compound Library|Antiinfection Compound Library|Anti-infection Compound Library|Antiinfection Compound Library|buy Anti-infection Compound Library|Anti-infection Compound Library ic50|Anti-infection Compound Library price|Anti-infection Compound Library cost|Anti-infection Compound Library solubility dmso|Anti-infection Compound Library purchase|Anti-infection Compound Library manufacturer|Anti-infection Compound Library research buy|Anti-infection Compound Library order|Anti-infection Compound Library mouse|Anti-infection Compound Library chemical structure|Anti-infection Compound Library mw|Anti-infection Compound Library molecular weight|Anti-infection Compound Library datasheet|Anti-infection Compound Library supplier|Anti-infection Compound Library in vitro|Anti-infection Compound Library cell line|Anti-infection Compound Library concentration|Anti-infection Compound Library nmr|Anti-infection Compound Library in vivo|Anti-infection Compound Library clinical trial|Anti-infection Compound Library cell assay|Anti-infection Compound Library screening|Anti-infection Compound Library high throughput|buy Antiinfection Compound Library|Antiinfection Compound Library ic50|Antiinfection Compound Library price|Antiinfection Compound Library cost|Antiinfection Compound Library solubility dmso|Antiinfection Compound Library purchase|Antiinfection Compound Library manufacturer|Antiinfection Compound Library research buy|Antiinfection Compound Library order|Antiinfection Compound Library chemical structure|Antiinfection Compound Library datasheet|Antiinfection Compound Library supplier|Antiinfection Compound Library in vitro|Antiinfection Compound Library cell line|Antiinfection Compound Library concentration|Antiinfection Compound Library clinical trial|Antiinfection Compound Library cell assay|Antiinfection Compound Library screening|Antiinfection Compound Library high throughput|Anti-infection Compound high throughput screening| in 10 mM sodium phosphate buffer (pH 7.4). The EC50 is reported. a, The EC50s were found to be 2.9 μg/ml for NA-CATH and 1.3 μg/ml for LL-37. b, EC50s were found to be 0.51 μg/ml for NA-CATH:ATRA1-ATRA1 and 2.9 μg/ml for NA-CATH. c, EC50s were found

to be 0.51 μg/ml for NA-CATH:ATRA1-ATRA1 and 1.3 μg/ml for LL-37. d, EC50s were found to be 0.52 μg/ml for ATRA-1 and 18 μg/ml for ATRA-2. e, EC50s were found to be 13 μg/ml for D-LL-37 and 1.3 μg/ml for LL-37. f, EC50s were found to be 0.73 μg/ml for ATRA-1A and 0.52 μg/ml for ATRA-1. Curves were fit to the data, and R2 values were as selleck chemical follows: 0.97 for NA-CATH:ATRA1-ATRA1; 0.98 for NA-CATH; 0.95 for LL-37; 0.95 for D-LL-37;

0.98 for ATRA-1; 0.96 for ATRA-2; 0.96 for ATRA-1A. Table 2 EC50s of AMPs against S. aureus Antimicrobial Peptides Molecular weight (g/mol) EC50 (μg/ml) 95% CI EC50 (μM) NA-CATH 5885.50 2.85 1.22-6.69 0.48 NA-CATH-ATRA1-ATRA1 5977.60 0.51 0.25-1.01 0.09 ATRA-1 2409.06 0.52 0.25-1.11 0.22 ATRA-2 2316.96 18.0 7.67-41.8 7.77 ATRA-1A 2332.96 0.73 0.33-1.62 0.31 LL-37 5177.42 1.27 0.44-3.72 0.25 D-LL-37 5177.42 12.7 6.48-24.9 2.45 This table indicates the EC50 of the peptides against S. aureus in an anti-microbial assay. (*) The molecular weight Oxymatrine reported here for each peptide reflects the TFA salts of the peptides. These molecular weights were then used to convert the EC50 in μg/ml to μM, to enable comparisons on a molecule by molecule basis. b. Synthetic peptides demonstrate anti-microbial activity against S. aureus S. aureus was also subjected to treatment with four synthetic peptides (Table 1), ATRA-1, ATRA-2, ATRA-1A, and NA-CATH:ATRA1-ATRA1, which represent variations on the ATRA-repeated motif of NA-CATH.